Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649221.1 | internal | 238 | 3-716(+) |
Amino Acid sequence : | |||
FFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAV GNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLV | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 26,388.963 | ||
Theoretical pI: | 9.407 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 49.076 | ||
aromaticity | 0.101 | ||
GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.298 | ||
sheet | 0.202 |