Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649225.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
SPAIFMEIVSGPISSCSKEHQKIYQEWFNCADLDGDGRITGTDAIKFFSMSNLSRPELKQVWAIADSKRQGFLGVKEFITAMQLVSLAQAGHEISESLSSTVDMQTIDPPVMEGLDVLLT KTKRSPKKIEPELAVPTPTQSSLSASWFTSKSVKKVPLSSVTSIIDGLKRLYIEKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKSSYPGAHIGPEPTTDRF VVVMSGTDERS | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 16,143.211 | ||
Theoretical pI: | 6.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 47.014 | ||
aromaticity | 0.068 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.304 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649225.1 | complete | 148 | 520-74(-) |
Amino Acid sequence : | |||
MYSRFKPSIIDVTELRGTFFTDFDVNQEAESEDWVGVGTANSGSIFLGERLVFVNSTSRPSITGGSMVCMSTVELRLSLISCPACARETNCIAVMNSFTPRNPCRLESAMAHTCFSSGRD KLDIEKNLIASVPVIRPSPSKSAQLNHS* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,143.211 | ||
Theoretical pI: | 6.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 47.014 | ||
aromaticity | 0.068 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.304 | ||
sheet | 0.223 |