Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649228.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
FLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPA MRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEK | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 26,480.910 | ||
Theoretical pI: | 8.970 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 46.241 | ||
aromaticity | 0.105 | ||
GRAVY | -0.110 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.291 | ||
sheet | 0.198 |