Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649240.1	3prime_partial	220	46-705(+)
Amino Acid sequence :
MPIESSIPTPLGPAAWEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHR
Physicochemical properties
Number of amino acids:		220
Molecular weight:		25,016.351
Theoretical pI:		6.113
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26360 26485
Instability index:		58.465
aromaticity		0.100
GRAVY		-0.387
Secondary Structure Fraction
Helix		0.305
turn		0.227
sheet		0.268