Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649249.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
FENLTLDGRGGKREDLAGYMDPCPFVRILVGNLGLKIPVASKPAGSGVHPSTSPCFCKIKLKHFPQQTAIVPLIPPETQFPDNQPQTLAASFHLSKADLEKLAAKSIFAAKPCLKIAIYT GRRGTTCGVNAGRLLGKVVLPLDLKGTESRGCVFQNGWVSVGKDAKKGSACTQIHLNVRAEPDPRFVFQFDGEPECSPQVFQIQGNIRQPVFTCKFSFRSSGDRNIRSRSMQSEQSGARS WLSSLGSERERPGKE | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 27,801.623 | ||
Theoretical pI: | 9.525 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14480 | ||
Instability index: | 48.712 | ||
aromaticity | 0.075 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.290 | ||
sheet | 0.204 |