Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649261.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
VVLDLSRMANQTIKLGDGLRQDCDAIRVIKAGMLRFSKPNKYWVETSHKRYVPCVGDTVLGIVVDSKAENFLVDIKGPTLAFLPVLAFEGGTRRNIPKFEAGTLLYVRVVKANTGMNPEL SCTDASGKAAEFGRLKDGFMFESSTGLSRMLLSSPTFPVLEALGKKLSFEIAVGLNGRVWVNAEAPSTVILVVNAIKASESLSATQQKIMVEKL | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 21,012.500 | ||
Theoretical pI: | 7.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 46.631 | ||
aromaticity | 0.103 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.330 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649261.1 | complete | 194 | 644-60(-) |
Amino Acid sequence : | |||
MSFSTIIFCWVALNDSDALIAFTTRMTVDGASAFTQTRPFNPTAISKDNFFPRASRTGNVGELSNIRDSPVDDSNMNPSFRRPNSAAFPLASVHESSGFMPVFALTTRTYSNVPASNFGI FLLVPPSNASTGRNANVGPLMSTRKFSALESTTMPRTVSPTQGTYLLCEVSTQYLFGFENLNIPALITLIASQS* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,012.500 | ||
Theoretical pI: | 7.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 46.631 | ||
aromaticity | 0.103 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.330 | ||
sheet | 0.222 |