Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649264.1 | 3prime_partial | 247 | 3-743(+) |
Amino Acid sequence : | |||
MESNYAATLSGLLKNAGDRFSSRRALSVSGKFDLSHSRLHFLIEHAAASLVASGVLPGDVVALTFPNTVEFVIMFLAVIRARATAAPLNQAYTADEFEFYLSDSESKILITPKEGNESAQ SAAAKLNIPHVTASLSDAESEVSLCSTHPEFNSKSTQVELIERVVNQPSDVALFLHTSGTTSRPKGVPLTQFNLASSVQNIKSVYKLTESDSTVIVLPLFHVHGLLAGLLSSLGAGAAVT LPSAGRF | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 17,262.824 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 114.825 | ||
aromaticity | 0.054 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.262 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649264.1 | 5prime_partial | 149 | 2-451(+) |
Amino Acid sequence : | |||
NGKQLRCDALRLAQERRRSVLFPPSPVRLRQVRSLPFSITFPHRTCRRFSRRLRRSSRRRRRSDLPKHRRVCDHVLGGNPSACYGGAAESGVHGGRVRVLLIRLRIEDLNHAERRKRIGS VRRGKAQHPSRYGFAFRRGIRGISLLDSP* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 17,262.824 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 114.825 | ||
aromaticity | 0.054 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.262 | ||
sheet | 0.181 |