Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649266.1 | 3prime_partial | 249 | 1-747(+) |
Amino Acid sequence : | |||
MASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTNYHFI VPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVI ETYFADVPA | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,749.997 | ||
Theoretical pI: | 9.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 43.756 | ||
aromaticity | 0.102 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.176 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649266.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
WRLTLLDTLARDQKESSNLHWNLSGMEKAVLKIWRRFRQTLGHPSGNKWRMLELSIFPAILFLTMTRCLTQQQCLVLFLLDTIGLVVRLDLTPISPWQEGMPQFLLWK* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,749.997 | ||
Theoretical pI: | 9.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 43.756 | ||
aromaticity | 0.102 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.176 | ||
sheet | 0.306 |