Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649267.1	3prime_partial	221	55-717(+)
Amino Acid sequence :
MPIESSIPTPLGPAGWEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHRE
Physicochemical properties
Number of amino acids:		221
Molecular weight:		25,131.438
Theoretical pI:		5.873
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26360 26485
Instability index:		58.804
aromaticity		0.100
GRAVY		-0.411
Secondary Structure Fraction
Helix		0.303
turn		0.231
sheet		0.267