Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649277.1 | internal | 271 | 3-815(+) |
Amino Acid sequence : | |||
LSLLASVSASSLTQKKPLPGAKTPAIPNRCGSKQARFISCEKKQGGEHGHENHVIDRRNVLLGIGGLYGATATIGSQGKVAIGAPVQPPDLSKCHLALDSDAGQEVNCCPPYSTANIIDF VPPSHDERLRRRKPAHMLNPEEIEKFKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMPEFY LDKMSPLYNDNRNHNHYNALMDYDYSIGDPN | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,591.383 | ||
Theoretical pI: | 6.625 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
Instability index: | 50.736 | ||
aromaticity | 0.103 | ||
GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.266 | ||
sheet | 0.232 |