Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649286.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
KNEANKMVVALVDMERVFVPPQHLIRLVQRRMERQRREEEQRNRSSKKGQEAEQTLLNRATSPQTGQQTGGSLKSMKDKSTQPEKDTQEGSALKTAGASKEITAGYLLKKSSKKNGWSRR WFVLNEKSGKLGYTKKEDEKHFHGVITLEECNIEELADEEEPPQKGSKDKKANGPDSAKTPSLLFKITSKIPYKTVLKAHSAVILKAESVADKNEWVTKIKSVTSKGSQGKGASSDAGLP IRQSLSDGSLDSMARRPADPEEELRWMSQEVRGYVEAVLNSLS | |||
Physicochemical properties | |||
Number of amino acids: | 283 | ||
Molecular weight: | 31,522.271 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 55.129 | ||
aromaticity | 0.042 | ||
GRAVY | -0.930 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.251 | ||
sheet | 0.272 |