Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649287.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
RLVADNSSSVLRSSCSTVPLVLSSSSFTIMETFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRNTCRNIGFVSNDVGLDADQCK VLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTIEYLNDHGAMVPVRVHTILISTQHDETVTNDEIAADLK EHVIKPVVPEKYLD | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 13,403.427 | ||
Theoretical pI: | 11.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53970 54095 | ||
Instability index: | 41.995 | ||
aromaticity | 0.124 | ||
GRAVY | 0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.339 | ||
sheet | 0.165 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649287.1 | 5prime_partial | 121 | 764-399(-) |
Amino Acid sequence : | |||
SSKYFSGTTGLMTCSLRSAAISSLVTVSSCWVEMRIVWTRTGTMAPWSFKYSMVTWVLPSGLNHGHVPFLRTSVRRAPSLVARTWVRGISSGVSSVAYPNIWPWSPAPISSGRLVKWPWT P* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,403.427 | ||
Theoretical pI: | 11.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53970 54095 | ||
Instability index: | 41.995 | ||
aromaticity | 0.124 | ||
GRAVY | 0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.339 | ||
sheet | 0.165 |