Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649294.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
SQADFGRLEIELAEVEMPGLMSCRSEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDD GGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLGIIRDGLKVDPKRYHKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKTKFDNLYGCRHSLPDGLMRATDIM IAGKVGVVCG | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,267.707 | ||
Theoretical pI: | 4.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
Instability index: | 42.760 | ||
aromaticity | 0.072 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.212 | ||
sheet | 0.280 |