Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649295.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
LSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKFGENRSSNSSINDHHEEYSNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPADLPAGAKPTDCCPPE NFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRYYLYFYERILGKLINDPSFAIPYWNW | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 26,460.765 | ||
Theoretical pI: | 8.439 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38765 | ||
Instability index: | 48.131 | ||
aromaticity | 0.110 | ||
GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.288 | ||
sheet | 0.225 |