Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649295.1	internal	236	2-709(+)
Amino Acid sequence :
LSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKFGENRSSNSSINDHHEEYSNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPADLPAGAKPTDCCPPE NFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRYYLYFYERILGKLINDPSFAIPYWNW
Physicochemical properties
Number of amino acids:		236
Molecular weight:		26,460.765
Theoretical pI:		8.439
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38390 38765
Instability index:		48.131
aromaticity		0.110
GRAVY		-0.367
Secondary Structure Fraction
Helix		0.301
turn		0.288
sheet		0.225