Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649298.1	3prime_partial	221	68-730(+)
Amino Acid sequence :
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHRE
Physicochemical properties
Number of amino acids:		221
Molecular weight:		25,062.398
Theoretical pI:		5.873
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20860 20985
Instability index:		60.234
aromaticity		0.095
GRAVY		-0.386
Secondary Structure Fraction
Helix		0.299
turn		0.226
sheet		0.271