Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649300.1	internal	237	1-711(+)
Amino Acid sequence :
AAKLDIDLNEGFPVDEGSQVDQVNSVGPGPSSIPPAGPLPFPLSSISSNLPSSVTVAAAAKGRFIFPENLTRNKGEIGWKGSAATSAFRPAEPRKVLEMPLATTDPSVDIVAGKQGRPPL DIDLNVPDERVLEDLVPHSSAQETCSESGLVSIQKFGHSEMVGSSAPFRSAGGLDLDLNRVDEATDVGHLSASTSRRTEVQPLSIRASSSSGFSNGEVNVLRNFDLNNGPGLDESSV
Physicochemical properties
Number of amino acids:		237
Molecular weight:		10,212.528
Theoretical pI:		6.227
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		44.535
aromaticity		0.050
GRAVY		-0.026
Secondary Structure Fraction
Helix		0.240
turn		0.340
sheet		0.300

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649300.1	complete	100	365-63(-)
Amino Acid sequence :
MSNGGRPCFPATISTEGSVVASGISRTFLGSAGLNALVAAEPFQPISPLFLVRFSGKIKRPLAAAATVTEEGRLLDMEERGKGRGPAGGIDEGPGPTELT*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		10,212.528
Theoretical pI:		6.227
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		44.535
aromaticity		0.050
GRAVY		-0.026
Secondary Structure Fraction
Helix		0.240
turn		0.340
sheet		0.300