Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649313.1 | 3prime_partial | 231 | 63-755(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHREEVLRVGAVFA | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 26,104.629 | ||
Theoretical pI: | 5.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
Instability index: | 59.569 | ||
aromaticity | 0.095 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.221 | ||
sheet | 0.277 |