Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649322.1 | 5prime_partial | 232 | 1-699(+) |
Amino Acid sequence : | |||
EHVSNDVDRGGTVSCHTDDGDYSGGFSKGLMENAAEKRSWLSKLSNFCSEDAKALITAFTVSMLFRSFMAEPRSIPSLSMYPTLDVGDRILAEKVSYLFRKPDVADIVIFNAPPVLQENG FSSGDVFIKRIVAKEGDYVEVRDGKLLVNGIIQDEDFILEPLAYEMDPVLVPDGYVFVMGDNRNNSFDSHNWGPLPIKNIVGRSVLRYWPPSKISDTIYEPQAGHNNVVAVS* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 11,585.817 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 55.234 | ||
aromaticity | 0.094 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.321 | ||
sheet | 0.226 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649322.1 | complete | 106 | 383-63(-) |
Amino Acid sequence : | |||
MNTSPELKPFSCRTGGALKITISATSGFLKRYDTFSANILSPTSRVGYIESDGIDLGSAMKDRNNIDTVNAVIRAFASSEQKFDNLESQLRFSAAFSINPFENPPE* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,585.817 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 55.234 | ||
aromaticity | 0.094 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.321 | ||
sheet | 0.226 |