Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649325.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
PNNSSYNSILQSKIKMVRLASSGIPKPRLIITPLHESHVQKAVICCRKHGFQVRTRSGGHDYEGLSYTTYNDIVPFVVLDLFNLQTISVDVEDGTAWVQVGATLAQVYYKIADKTSTYGF PAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKILNKDSMEEELFWAIRGGGGASFGIVLSWKIKLAPVPPTVTVFRIQRTLEEGATALVHKWQYIAHKLPKDLTIYGI VTKVNAKEAG | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,283.092 | ||
Theoretical pI: | 9.245 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 22.956 | ||
aromaticity | 0.092 | ||
GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.248 | ||
sheet | 0.192 |