Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649331.1 | 3prime_partial | 217 | 76-726(+) |
Amino Acid sequence : | |||
MAFASRIVSRSKQLYAGQIILQREHLVPVRFFAKEAAPPALKGDEMLKNIFLEVKNKFETALGVLRKEKIVIDPDDQAAVAQYAKVMKNVREKADLFSESQRIQYTIQSRTQNIPDARTY LLTLQEIRIKRGLTDELGAEAMMMDALEKVEKELKKPLMRSDKKGMSLLLAEFDKINKKLGIRKEDLPKYEEQLELKIAKAQLEELKKDAHEAMETQ | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 24,961.909 | ||
Theoretical pI: | 9.154 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 38.787 | ||
aromaticity | 0.055 | ||
GRAVY | -0.495 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.124 | ||
sheet | 0.369 |