Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649338.1 | internal | 274 | 823-2(-) |
Amino Acid sequence : | |||
LASNESPHVKIRTGSHFVRSNPATYRAGEGTGILEWHQVFALGQNRQDSGNATLEITVWDGPTEQFLGGVCFDLSDVPVRDPPDSPLAPQWYRLEGGDDQQPNRVSGDIQLSVWIGTQAD DAFPESWSSDAPYVAHTRSKVYQSPKLWYLRVTVIEAQDIHIAPPATASPPPTAIAPSDIRVKAQLGFQSARTRRGLMNNHNSSFFWNEDLVFVAGEPLEEQLVLLVEDRASKDPVLLGH AVVPLISVEQRFDERRVASKWLGLEGQGTGAGPA | |||
Physicochemical properties | |||
Number of amino acids: | 274 | ||
Molecular weight: | 12,385.447 | ||
Theoretical pI: | 11.739 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 97.309 | ||
aromaticity | 0.046 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.241 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649338.1 | 5prime_partial | 108 | 1-327(+) |
Amino Acid sequence : | |||
QPVQLRFLVLPVLTTWKLPGVHRNVARLRSEELRRGRGARDPYSPCLPRAILTVLPEARRRRTRGLRSRKRKSCDCSSSLVLFAPIENLIVLSRGCRRAQSPWGAEMQ* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,385.447 | ||
Theoretical pI: | 11.739 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 97.309 | ||
aromaticity | 0.046 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.241 | ||
sheet | 0.259 |