Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649349.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
NVLLWNAMLKGFAENELYAQTLVLFNQMNSRNVSPSCFTFPFVLKSCIKISAFKEGKKLHCLIIKTGVSQNRFIGTLLIDIYSGEREIEYARKVFDEMPVKNAVAWTSIISANILSGHVE FARTLFNMTTERDIVLWNTMVSGHISIGDMVTARELFDEMPNRDVMCWNTILLGYFSNNDVEGGEMFFKEIPEKNIFSWNGLISGYTRNSRFFEVLGSFKRMLVESSVRPNDTTLVTVLS ACSRLGAL | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 14,528.897 | ||
Theoretical pI: | 10.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 57.275 | ||
aromaticity | 0.061 | ||
GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.298 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649349.1 | 5prime_partial | 131 | 748-353(-) |
Amino Acid sequence : | |||
DRAPNLEQADKTVTSVVSLGRTLDSTSILLKLPKTSKNRLFRVYPEISPFQENMFFSGISLKNISPPSTSLLLKYPSKMVFQHITSLLGISSNSSLAVTMSPMLICPETIVFHKTISRSV VMLKRVRANST* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,528.897 | ||
Theoretical pI: | 10.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 57.275 | ||
aromaticity | 0.061 | ||
GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.298 | ||
sheet | 0.221 |