Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649354.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
SLAATAIATAITTILQINPGFVTMADTQSVATLIDSATTKIQQLQQAFAELENHRAVTLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYENKASEARVMLEKREAAVVAKEQASLEKL QETRDAALFAIGDVLKKHKSSSAEPPVVKLESCDVINTTMEEKPPDVKDIVVDSEETKTPSKKDHTIDLKARPQLLKLCEEMDANGLHTFISDNRKNLAAIREEIPFALKAASDPARLVL DSLDDFYRMEMPSLDGKRDSSLLGL | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,064.584 | ||
Theoretical pI: | 5.245 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 78.236 | ||
aromaticity | 0.045 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.300 | ||
sheet | 0.291 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649354.1 | complete | 110 | 424-92(-) |
Amino Acid sequence : | |||
MMTCASSEHPQWQREQHLSSPEASPMRLALSLQQQLHASPASLGLQMPCSHIPFPGPPIHGIFSLRISQDHESVPQVPSISDSGSQLDDFQAQQMLVEVAVSWLLQSLLA* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,064.584 | ||
Theoretical pI: | 5.245 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 78.236 | ||
aromaticity | 0.045 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.300 | ||
sheet | 0.291 |