Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649382.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
LFAGFPATDLKTAVETAGDVTQMQAQVVFVGTQFGVGSPDVPMPSNISLANDGFLCTKPTSQGKNDMSACCVKDPKFKADVVEEEFLPRQTGDLTIDYDVLRSYDSEYYAQVKIVNHNPL GRLDNWQLSWDWMRDEFIYSMKGAYPSLVDSTDCIFGRQGTYYKDFDFSNVLSCAKRPTIIDLPLTKANDSNLGLIPFCCRNGTILPPNMDPSKSVSVFQLQVKKMPPDLNRTQLFPPQN W | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,965.346 | ||
Theoretical pI: | 4.817 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
Instability index: | 46.063 | ||
aromaticity | 0.108 | ||
GRAVY | -0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.261 | ||
sheet | 0.187 |