Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649391.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
RSFHSVLHVGLHMIEQPLGPGTIRNPESEPEMTWKRAELSVMLEHVQAHVAPTDVDPGAGLQWLPKILRSSPKVKRTGALLERVFMPCTMYFRYTRHKGGTADLKVKPLKELAFNSPNIT ASMTSRQFQVMLDVLSNLLFARLPKPRRSSLSYLSENDEDVEEEADEVVPDGVEEVELARINLERTERERKLILDDIRKLSVGGDTSGELCLSPEDVTNLWMITCGRSTLVQGLKKELGS TQKS | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,432.182 | ||
Theoretical pI: | 6.133 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 51.314 | ||
aromaticity | 0.049 | ||
GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.234 | ||
sheet | 0.299 |