Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649428.1 | 3prime_partial | 240 | 91-810(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFRGLYHREEVLRVGAVFASGLLRAIRF | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 27,171.896 | ||
Theoretical pI: | 6.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
Instability index: | 58.159 | ||
aromaticity | 0.096 | ||
GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.221 | ||
sheet | 0.279 |