Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649441.1	5prime_partial	256	2-772(+)
Amino Acid sequence :
KDLTIIGVVRKVNAKEAGNKTVQVSFSSLFLGLTKQLLPIMEQSFPELGLKPEDCTEISWRQSVPFLAEMPMNSSLSDLAINQQKMLFKSKLDCVKEPIPEIVFKKLWKMFLEVDVPVMT LIPYGGRMSEIPDSEIPFPHRAGNIFHIGYFVFLNQNEGTAASKKNMDWIRRLYNYMTPYVSKSPRGAYLNYRDLDLGYTKNGTATYAEAKVWGSKYFKNNFDRLVQVKSKVDPDNFFRN EQSIPPVLSLADGKKN*
Physicochemical properties
Number of amino acids:		256
Molecular weight:		29,236.517
Theoretical pI:		9.212
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		36900 37025
Instability index:		41.893
aromaticity		0.113
GRAVY		-0.325
Secondary Structure Fraction
Helix		0.332
turn		0.258
sheet		0.230