Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649443.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
NPPDGIHEKMIPGEKIIPVIDLEGVNKGKDVDRRKEIINQVRHAAETWGFFQVENHGIPVEIMDEINEAIREFNEQPREERRKFYTRDRSRKVIYNSNFDLYESPAANWRDSIGFIVAPN CPSPEDLPLAFRSILMEYSKHVMELGIVLFELLSEALGLNGNHLNEMGCSEGLLFLGHYYPPCPQPELTIGTPKHSDNDFLTILLQDSIGGLQVLHQNKWLDIPPFRGALVVNIGDILQL ISNDRFKSSEHRVLANGIGPRVSVASLFTTYNQES | |||
Physicochemical properties | |||
Number of amino acids: | 275 | ||
Molecular weight: | 31,200.052 | ||
Theoretical pI: | 5.230 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 46.964 | ||
aromaticity | 0.084 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.273 | ||
sheet | 0.244 |