Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649444.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
ELRLICEREISIQQQRTTNSAISLRKSLQSIQLTAHQTAQDQAKLCQLKAQLRELEDDLVKALAVKTRKEAKRMALADSISAAKARTEELKKNLQDQKAIRDECATIISQQLLALTTLEE KANIGNKRKEELQQAISWYNKVLGLRIEGGHGVKFIFNKINMKSPEQEYSFTVRHANSTYTLLDCCPHLADTNELMQEMNQTNGLFKFVKIMRQKFQAAASTASISEDLWTVSTSAPTFS VSCDGSESSEKENEVHV | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 28,961.660 | ||
Theoretical pI: | 8.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 47.709 | ||
aromaticity | 0.047 | ||
GRAVY | -0.502 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.171 | ||
sheet | 0.311 |