Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649453.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
GMRPALVVSNWEVAKECFTANDRALASRPTSLALKIMGYNNSLFAFAPYGQYWRELRKIVMHQLLSSRRLELLKNVWLSEIDIWIKGLYENSLVNKVVDMKQWFGELMMNIVVRLVAGKR SFGKIREGDSEEAKAHQRQIKALRDFFRLVEVFMIEDAFPFLTWLDPRGYQKEMKNIAKELDYLLEEWLEEHKLKQQAACDDQSKDFMDVMLSEVKDSTITERDANTICKATCLNVILGA SDTTTLTLTWALSLLLN | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 29,752.196 | ||
Theoretical pI: | 6.412 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 53190 | ||
Instability index: | 40.121 | ||
aromaticity | 0.097 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.163 | ||
sheet | 0.327 |