Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649470.1	3prime_partial	160	94-573(+)
Amino Acid sequence :
MGKEVEVTETGEFSAKDYHDPPPAPLFDPDELTKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDPAKNPDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV SLIRALGYMVAQCLGAICGVGLVKAFQKAYYVRYGGGANI
Physicochemical properties
Number of amino acids:		160
Molecular weight:		14,670.001
Theoretical pI:		5.763
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		48.560
aromaticity		0.060
GRAVY		-0.587
Secondary Structure Fraction
Helix		0.261
turn		0.299
sheet		0.201

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649470.1	5prime_partial	134	573-169(-)
Amino Acid sequence :
YVSSTTITHIISLLECLHQPNATYGSQTLRHHVPQSSDQRYLPCQKQPKSHRGIYVSSGDTGGAVDEDEDHAAKSPGDSENTNATTLIWVLSRISLALVTYHCKNSNVEKEKSSYELSNK SPVEGPFGELVGVE*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,670.001
Theoretical pI:		5.763
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		48.560
aromaticity		0.060
GRAVY		-0.587
Secondary Structure Fraction
Helix		0.261
turn		0.299
sheet		0.201