Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649505.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
QRPETGKEKRNNDFDLVIIHRSMAEKHYKYVILGGGVAAGYAAREFAKQGVKPGQLAIISKEAVAPYERPALSKAYLFPEAPARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKA DLASKTLTSAVGATFKYETLIIATGSTVIRLSDFGVQGADAKNIFYLREIEDADKLIEAIKVKKDGKAVIVGGGYIGIELGAVMKINNFDVTMVFPEPWCMPRLFTAEIAAFYEGYYAKK GV | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 26,458.323 | ||
Theoretical pI: | 8.368 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 42.749 | ||
aromaticity | 0.103 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.207 | ||
sheet | 0.289 |