Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649528.1 | 5prime_partial | 272 | 2-820(+) |
Amino Acid sequence : | |||
LRVAGRRLSCMSWRSSQTAPAMIPRNIINGEDSVSDESRALSYHHEFSSRSALYNPFRGFASEALTPRGDFGMISDLPATEAAVKNPSSKIVYDEHNHERFPPGDPSKRAFAYFVLTGGR FVYASLVRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEDDINLANSVDVGSLRHPQQDSERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPFNLEVPTYTFLDDNKLLIG* | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 11,856.582 | ||
Theoretical pI: | 10.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 55.302 | ||
aromaticity | 0.067 | ||
GRAVY | -0.564 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.257 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649528.1 | complete | 105 | 712-395(-) |
Amino Acid sequence : | |||
MARAKPPTKITSIRKWDAAKMCTNPNNNKPFRVFNPLRILLWMAKGSHIDTVGQIDVIFSPASDKDWLPTPLDSHSGSRLDAGEVYLKRGQSKHILASRHTQHKL* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,856.582 | ||
Theoretical pI: | 10.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 55.302 | ||
aromaticity | 0.067 | ||
GRAVY | -0.564 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.257 | ||
sheet | 0.200 |