Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649530.1 | internal | 235 | 1-705(+) |
Amino Acid sequence : | |||
ILKIPISFAEVLLWVVLTYYGIGYDPNIQRFFRHYLILLLTNQMASGLFRVAAATARDMIIANTFGSFAQLVVLALGGYLLSRENVKKWWIWGYWTSPLMYGQNAIAVNEFLGHSWSHIN PSTNTTLGVAVLKSRGVFTSSSWYWIGVAGLVGYIFLFNGIFTLALTFLKPIKSSQAVLSEEALIEKHANRTGEVELSSKAKKPSAGSTKFRSDNDNNNINRRSSIVESTSGGAI | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 13,427.629 | ||
Theoretical pI: | 5.216 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 37.288 | ||
aromaticity | 0.074 | ||
GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.215 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649530.1 | complete | 121 | 704-339(-) |
Amino Acid sequence : | |||
MAPPLVDSTIEDLLLMLLLSLSDLNFVDPALGFFALDDNSTSPVLLACFSISASSDNTAWDDLIGLRKVRARVKIPLKRKMYPTNPATPIQYQDELVKTPRDFKTATPKVVLVLGLIWLQ L* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,427.629 | ||
Theoretical pI: | 5.216 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 37.288 | ||
aromaticity | 0.074 | ||
GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.215 | ||
sheet | 0.298 |