Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649537.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
LERESKMREILHVQGGQCGNQIGAKFWEVVCAEHGIDPTGKYQGDSGLQLERINVYYNEASCGRFVPRAVLMDLEPGTMDSIRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELID SVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMS GVTCCLRFPGQLNSDLRKLAVNLI | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 11,670.384 | ||
Theoretical pI: | 6.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
Instability index: | 48.539 | ||
aromaticity | 0.107 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.223 | ||
sheet | 0.291 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649537.1 | complete | 142 | 431-3(-) |
Amino Acid sequence : | |||
MTNLEPLQAIAVLSFFPDNIKNRINKFRSFRVMSFGPVVSGTGLSENEVIRSENLTVGSRSDAVHGARLEIHENSARNEPSATGFIVVDINPLKLKTGVALVLSGGIDPVLGAHHFPELG PDLVAALASLNVKDLTHFAFSL* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 11,670.384 | ||
Theoretical pI: | 6.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
Instability index: | 48.539 | ||
aromaticity | 0.107 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.223 | ||
sheet | 0.291 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649537.1 | complete | 103 | 163-474(+) |
Amino Acid sequence : | |||
MSTTMKPVAEGSFLALFSWISSLAPWTASDLDPTVRFSDLITSFSDSPVPETTGPKDITRKERNLLILFLMLSGKKLRTAIACKGSRFVIRWEEELDLAWERF* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,670.384 | ||
Theoretical pI: | 6.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
Instability index: | 48.539 | ||
aromaticity | 0.107 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.223 | ||
sheet | 0.291 |