Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649541.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
ENEKMWKVIHWFAILPLISLLATQVSSDSSDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCPPSVFKEKKEALGEVLNGDRLVSAPYKLDFLVEKDAEHVCKKTLTKEEVVQFRNA VAKDYYFQMYYDDLPIWGFIGKVDKEGKTDPSEYKYYLYKLIHFDILYNKDRVIEINVRTDPNALVDLTEDKPVEAEFTYTVKWKETGIPFEKRMDKYSQTSSLPHHLEIHWFSIINSCV TVLLLTGF | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 28,995.788 | ||
Theoretical pI: | 5.790 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51340 51465 | ||
Instability index: | 36.070 | ||
aromaticity | 0.141 | ||
GRAVY | -0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.190 | ||
sheet | 0.226 |