Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649551.1 | 3prime_partial | 236 | 99-806(+) |
Amino Acid sequence : | |||
MVFFRGVSALSKLRSRVVQQSCLSNSVRWLQIQSSPDQDLHSQLKDLIPEQQERLKKIKADYGKVQLGNVTVDMVIGGMRGMTGLLWETSLLDPDEGIRFRGLSIPECQRVLPAATPGGE PLPEGLLWLLLTGKVPTKEQVDVLSKELQSRATVPDHVYKAIDALPITAHPMTQFATGVMALQVQSEFQKAYEKGISKSKFWEPTYEDSLNLIAQVPVVASFVYRRVFKDGKIVPS | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 26,306.186 | ||
Theoretical pI: | 8.798 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 44.533 | ||
aromaticity | 0.072 | ||
GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.225 | ||
sheet | 0.250 |