Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649552.1 | 3prime_partial | 252 | 3-758(+) |
Amino Acid sequence : | |||
MASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTNYHFI VPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVI ETYFADVPAEAY | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 12,878.127 | ||
Theoretical pI: | 9.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 43.447 | ||
aromaticity | 0.101 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.174 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649552.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
QWRLTLLDTLARDQKESSNLHWNLSGMEKAVLKIWRRFRQTLGHPSGNKWRMLELSIFPAILFLTMTRCLTQQQCLVLFLLDTIGLVVRLDLTPISPWQEGMPQFLLWK* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,878.127 | ||
Theoretical pI: | 9.886 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33125 | ||
Instability index: | 43.447 | ||
aromaticity | 0.101 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.174 | ||
sheet | 0.303 |