Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649557.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
EAVNAYFSEGDRNIAPTTAARAPQDDLMAVDNDPLVAEFQQRPFSLLPSAPNLNPFSLLDANFRRSFFEGRVPADLVGGAPRVTHPREVREIPIEVKDGNNEVGHSGSRPTIEEVSETAH ADEPEIRGHVILNDDDDEDIQAATGAHSAGQNERSDGFSGNNLHGRHTRSSVPVLDSVADCGDDIEEEMIQAAIEA | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,189.692 | ||
Theoretical pI: | 4.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 55.832 | ||
aromaticity | 0.046 | ||
GRAVY | -0.596 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.276 | ||
sheet | 0.276 |