Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649573.1	internal	277	3-833(+)
Amino Acid sequence :
NIEMDEHTFMVNRERAVDHLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMK KGLFSVMHYLMPKRQILSLHSGCNMGRDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWSENGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENIVFDEHTREVDFSDKSVTEN TRAAYPIEYIPNAKLPCVGPHPKNVILLACDAFGVFP
Physicochemical properties
Number of amino acids:		277
Molecular weight:		31,566.429
Theoretical pI:		5.522
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31400 31900
Instability index:		40.442
aromaticity		0.101
GRAVY		-0.348
Secondary Structure Fraction
Helix		0.300
turn		0.235
sheet		0.231