Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649592.1 | internal | 277 | 3-833(+) |
Amino Acid sequence : | |||
FKNSSFLSLNYSNIALLFLMSFFPSSIADIFPTANSLLPDSVCNATLYPKFCKSELPPNGLNNIHDYSRVSVRRSLSSALKFQALVDRYLAKKSTLSRSATDALQVCQFLAALNVDYLQS TSNVLQAITNTLSTIKVEDLQTLLSAILTNHQTCLDCLQSTASAWSIRNGLSMPLSNGTKLYSVSLALFTRGWVRKLKRKGTLELSGRKLLFSDEDAGAIPRGHDLPLRMSSHDRKIFES VTGRKLFQTYEDVLPTIPNGVKVRNLVVVNPNGSGNF | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 30,587.799 | ||
Theoretical pI: | 9.575 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 36.707 | ||
aromaticity | 0.083 | ||
GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.282 | ||
sheet | 0.249 |