Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649596.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
SNGFSSVTNGVDGEQRPKDLSVKAASVPDRAGKLPKTSSNLARIVELGLLLGLWYLFNIYFNIFNKQVLKVYPFPITVSAVQFAVATAVVLLMWAFNLYKRPKITTSQLLSILPLAILHT LGNLATNISLGKVSVSFTHTIKAMEPFFTVVLSALFVGEMPTLSVVLSLLPIVGGVALASLTEASFNWIGFWSAMSSNLANQSRNVFSKKIMVKKEESLDNVTLFSIMTIMSFILNVPVT LFM | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 14,900.180 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 23.682 | ||
aromaticity | 0.044 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.230 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649596.1 | complete | 135 | 729-322(-) |
Amino Acid sequence : | |||
MKSVTGTFNMNDIIVIMEKSVTLSKDSSFLTMIFLLNTLRDWLARLDDIALQKPIQLKEASVREANATPPTIGSRDNTTDSVGISPTNKAERTTVKKGSIALIVCVKETETFPRLMFVAR LPNVCNIANGRIDKS* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,900.180 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 23.682 | ||
aromaticity | 0.044 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.230 | ||
sheet | 0.237 |