Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649601.1 | 3prime_partial | 228 | 42-725(+) |
Amino Acid sequence : | |||
MELFNNAKTVRLRSHHDKYLLADEDEESVIQARNGSSKTARWAVEFIHDGSFIRLKSCFGKYLTASNAPFLLGMTGRKVLQTLPRRLDSSLEWEPIRDGSQVKLKTRYGHFLRANGGVPP WRNSVTHDIPHRTATQDWVLWDVDVLEIQVVQSPTTTTVNPAAGQAVVDSEEPPSPSLKPSDSFSSVASKHKMVEGRTIYYSIANDGGNVDDGIEGLSLIFKGNSVEE | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 23,058.448 | ||
Theoretical pI: | 11.874 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 71.014 | ||
aromaticity | 0.070 | ||
GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.305 | ||
sheet | 0.160 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649601.1 | 5prime_partial | 200 | 725-123(-) |
Amino Acid sequence : | |||
FLNAIPFKDQRQTFNPIINISTVIGNTVINRPTLHHFMLRSNGRKRITRLQTGRWRFFRIYNSLTSCRIHGGGGGRLNHLNLQNINIPQNPILRRCSMRNIMSNRVPPWRNPSISSQKMA VPCLELNLRPISNGFPFQRRIKSSGQRLKHLATSHPQKKRRVRSCQVLPETAFETDEAAVVYELHGPPRRFGRPVSGLDH* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 23,058.448 | ||
Theoretical pI: | 11.874 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 71.014 | ||
aromaticity | 0.070 | ||
GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.305 | ||
sheet | 0.160 |