Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649611.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
KYRSYIYGEGEKDTVWRLGAPPNYDVVNKLFEEGRTQVWSEDSMEGKVQRLVKTWEMEIVHKIRPQDFKTINAEKYRFSLNGEPPVTLDSLIKIGSYNAFLATSMPENFRGYNPAAETAE SANKKFTTIFPRGFALEILQVYSGPPVIVYKFRHWSFMDGPFNGHAATGEAH | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 19,706.039 | ||
Theoretical pI: | 7.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
Instability index: | 29.563 | ||
aromaticity | 0.140 | ||
GRAVY | -0.531 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.250 | ||
sheet | 0.233 |