Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649620.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
HLLMAGKHFKYVIIGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSAAGLTFKYDT LLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDSNADG EVRAVKLKD | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 11,648.132 | ||
Theoretical pI: | 7.181 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 41.703 | ||
aromaticity | 0.129 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.277 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649620.1 | 3prime_partial | 122 | 368-3(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATPPPMITYLKCFPAI NK | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 11,648.132 | ||
Theoretical pI: | 7.181 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 41.703 | ||
aromaticity | 0.129 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.277 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649620.1 | 5prime_partial | 101 | 747-442(-) |
Amino Acid sequence : | |||
ILQFHCSHLPICIGIKSNCNCSLDNFDSFVSIVTFIECSYSRSEETRHAPWFRVHHSNVEVVKLHYSAKLETNVSSTNNHSLTILFCINSYYKFISIINFS* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,648.132 | ||
Theoretical pI: | 7.181 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 41.703 | ||
aromaticity | 0.129 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.277 | ||
sheet | 0.139 |