Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649622.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
EDLLMAGKHFKYVIIGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSAAGLTFKYD TLLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDSNAD GEVRAVKLKDGRVLGADIVVVGVGG | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 13,207.637 | ||
Theoretical pI: | 6.340 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.345 | ||
aromaticity | 0.112 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.319 | ||
sheet | 0.138 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649622.1 | 3prime_partial | 124 | 373-2(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATPPPMITYLKCFPAI NKSS | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,207.637 | ||
Theoretical pI: | 6.340 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.345 | ||
aromaticity | 0.112 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.319 | ||
sheet | 0.138 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649622.1 | 5prime_partial | 116 | 797-447(-) |
Amino Acid sequence : | |||
SANTNNNNISTEDPSILQFHCSHLPICIGIKSNCNCSLDNFDSFVSIVTFIECSYSRSEETRHAPWFRVHHSNVEVVKLHYSAKLETNVSSTNNHSLTILFCINSYYKFISIINFS* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,207.637 | ||
Theoretical pI: | 6.340 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.345 | ||
aromaticity | 0.112 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.319 | ||
sheet | 0.138 |