Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649653.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
SFLISNQVPVTRDLMATIQSVKARQIFDSRGNPTVEVDIKLSNGTFARAAVPSGASTGVYEALELRDGGSDYLGKGVLKAVDNVNSIIAPALIGKDPTDQSGIDNYMVQHLDGTVNEWGW CKQKLGANAILAVSLAVCKAGASVKNIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENK EGLELLKTAIAKAGYTGKVVIGMDVAASEFYT | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 28,777.708 | ||
Theoretical pI: | 8.365 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 28.338 | ||
aromaticity | 0.066 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.265 | ||
sheet | 0.265 |