Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649662.1	internal	259	1-777(+)
Amino Acid sequence :
EVVDVLPRALEDDGFVARHSHMKYELRDTPGLVPIGLYGLQHYISILGSLILIPLVIVPAMGGSHEDTSMVVSTVMFVSGVTTLLHTFFGSRLPLIQGPSFVYLAPALAIINSPEFLGLN GNNFRHIMKELQGAVIISSAFQVLLGYSGLMSLFLRLINPVVVSPTVAAVGLSFYSYGFPQVGTCLEIGAVQILLVVIFSLYLRKISVFGHRVFLIYAVPLGLAITWAIAFLLTEAGAYT YKGCDLNVPASNIVSEACR
Physicochemical properties
Number of amino acids:		259
Molecular weight:		28,002.700
Theoretical pI:		6.399
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21890 22015
Instability index:		39.928
aromaticity		0.104
GRAVY		0.788
Secondary Structure Fraction
Helix		0.440
turn		0.251
sheet		0.274