Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649681.1 | internal | 226 | 1-678(+) |
Amino Acid sequence : | |||
TFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIA VGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTN | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 25,080.568 | ||
Theoretical pI: | 9.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 50.330 | ||
aromaticity | 0.102 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.288 | ||
sheet | 0.199 |