Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649681.1	internal	226	1-678(+)
Amino Acid sequence :
TFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIA VGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTN
Physicochemical properties
Number of amino acids:		226
Molecular weight:		25,080.568
Theoretical pI:		9.671
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23380 23380
Instability index:		50.330
aromaticity		0.102
GRAVY		0.006
Secondary Structure Fraction
Helix		0.363
turn		0.288
sheet		0.199