Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649685.1 | 3prime_partial | 246 | 42-779(+) |
Amino Acid sequence : | |||
MASAPEATSGSLKSRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIDSALKRANVDPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKAIMLAAQSIQLGIN DVVVAGGMESMSNVPKYLSEARKGSRLGHDTLVDGMLKDGLWDVYNDYGMGVCAELCADQHNITREEQDAYAIQSFERGIAARDSGAFAWEIAPVEVSGGRGRPSTLVDTDEGLDKFDPV KLRKLR | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 12,481.125 | ||
Theoretical pI: | 4.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 53.711 | ||
aromaticity | 0.042 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.242 | ||
sheet | 0.317 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649685.1 | complete | 120 | 385-23(-) |
Amino Acid sequence : | |||
MLCAASIIAFIPDAQTLLTVVQTTELGIPAPNAACLAGACPKFALRTFPKKTSCTSDGSTFARLSAESIAIDPSLVADKDESEPRKPPIGVRATPTMHTSRDFSEPEVASGAEAMATSEI * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,481.125 | ||
Theoretical pI: | 4.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 53.711 | ||
aromaticity | 0.042 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.242 | ||
sheet | 0.317 |